PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G27470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 256aa    MW: 27536.9 Da    PI: 9.0276
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G27470.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97e-18114168256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ ++tkeq + Le+ F+ ++ +s++++ eLA++l+L+ rqV vWFqNrRa+ k
  OGLUM06G27470.1 114 RKKLQLTKEQSTLLEDSFRVHNILSHAQKHELARQLKLKPRQVEVWFQNRRARTK 168
                      778899***********************************************98 PP

2HD-ZIP_I/II117.47.9e-38114202190
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                      +kk++l+keq++lLE+sF+ ++ L++ +K+elar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een++L++e  eLr +
  OGLUM06G27470.1 114 RKKLQLTKEQSTLLEDSFRVHNILSHAQKHELARQLKLKPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCESLTEENKQLKHELMELR-R 202
                      69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-1894171IPR009057Homeodomain-like
SuperFamilySSF466897.27E-1998171IPR009057Homeodomain-like
PROSITE profilePS5007117.038110170IPR001356Homeobox domain
SMARTSM003892.4E-13112174IPR001356Homeobox domain
PfamPF000463.4E-15114168IPR001356Homeobox domain
CDDcd000861.42E-12114171No hitNo description
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
PfamPF021831.9E-9170202IPR003106Leucine zipper, homeobox-associated
SMARTSM003406.3E-17170213IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MEGEDLGSWL GLGIGGGGYA YGGDDCQRSP SSPSPVQMLF SQHVKEEITR GYDHGRDEEQ  60
ASGSKIMKGE RGARLRVMRS IRNSGGDGSR SRVLSLGDDG GDGGSGGGGG GGTRKKLQLT  120
KEQSTLLEDS FRVHNILSHA QKHELARQLK LKPRQVEVWF QNRRARTKLK QTEVDCEFLK  180
RCCESLTEEN KQLKHELMEL RRLASAAAAA AGSQLYVQFP RAAAAAMVNV CPSCEKVTVM  240
GGGGGETGKS SSSYSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162170RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0054450.0AP005445.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0028E05.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643687.10.0PREDICTED: homeobox-leucine zipper protein HOX18
SwissprotA2YGL90.0HOX18_ORYSI; Homeobox-leucine zipper protein HOX18
TrEMBLA0A0E0ADT90.0A0A0E0ADT9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA020603-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81303448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-46homeobox from Arabidopsis thaliana